PDB entry 1ufm

View 1ufm on RCSB PDB site
Description: Solution structure of the PCI domain
Class: signaling protein
Keywords: helix-turn-helix, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-06-02, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COP9 complex subunit 4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O88544 (7-77)
      • cloning artifact (0-6)
      • cloning artifact (78-83)
    Domains in SCOPe 2.07: d1ufma1, d1ufma2, d1ufma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufmA (A:)
    gssgssggssildraviehnllsasklynnitfeelgalleipaakaekiasqmitegrm
    ngfidqidgivhfetreasgpssg