PDB entry 1ufm

View 1ufm on RCSB PDB site
Description: Solution structure of the PCI domain
Class: signaling protein
Keywords: helix-turn-helix, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-06-02, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: COP9 complex subunit 4
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O88544 (7-77)
    • cloning artifact (0-6)
    • cloning artifact (78-83)
  Domains in SCOPe 2.08: d1ufma1, d1ufma2, d1ufma3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ufmA (A:)
  gssgssggssildraviehnllsasklynnitfeelgalleipaakaekiasqmitegrm
  ngfidqidgivhfetreasgpssg