PDB entry 1ufl

View 1ufl on RCSB PDB site
Description: Crystal Structure of TT1020 from Thermus thermophilus HB8
Class: signaling protein
Keywords: Structural genomics, Signal Transducing protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses, SIGNALING PROTEIN
Deposited on 2003-05-31, released 2003-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulatory protein p-II
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83820 (0-End)
      • engineered (17)
    Domains in SCOPe 2.07: d1ufla_
  • Chain 'B':
    Compound: nitrogen regulatory protein p-II
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83820 (0-End)
      • engineered (17)
    Domains in SCOPe 2.07: d1uflb_
  • Chain 'C':
    Compound: nitrogen regulatory protein p-II
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83820 (0-End)
      • engineered (17)
    Domains in SCOPe 2.07: d1uflc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uflA (A:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uflA (A:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uflB (B:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uflB (B:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghelhekvrleigvsepfvkptveai
    lkaartgevgdgkifvlpvekvyrirtgeedeaavt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uflC (C:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uflC (C:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggttvkmelhekvrleigvsepfv
    kptveailkaartgevgdgkifvlpvekvyrirtgeede