PDB entry 1ufl

View 1ufl on RCSB PDB site
Description: crystal structure of tt1020 from thermus thermophilus hb8
Deposited on 2003-05-31, released 2003-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1ufla_
  • Chain 'B':
    Domains in SCOP 1.71: d1uflb_
  • Chain 'C':
    Domains in SCOP 1.71: d1uflc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uflA (A:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uflA (A:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeed
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uflB (B:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uflB (B:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghelhekvrleigvsepfvkptveai
    lkaartgevgdgkifvlpvekvyrirtgeedeaavt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uflC (C:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggetervetyrgttvkmelhekvr
    leigvsepfvkptveailkaartgevgdgkifvlpvekvyrirtgeedeaavtpvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uflC (C:)
    mklivaivrpeklnevlkalfqaevrgltlsrvqghggttvkmelhekvrleigvsepfv
    kptveailkaartgevgdgkifvlpvekvyrirtgeede