PDB entry 1ufk

View 1ufk on RCSB PDB site
Description: Crystal structure of TT0836
Class: transferase
Keywords: AdoMet-dependent methyltransferase-fold, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-05-31, released 2003-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.232
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TT0836 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufkA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepgmafgtghhettrlalkalarhlrp
    gdkvldlgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaal
    pfgpfdllvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrple
    eaaegewvllaygr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufkA (A:)
    mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwl
    eawrrdlkpalappfvvlapwhtwegaeiplviepghhettrlalkalarhlrpgdkvld
    lgtgsgvlaiaaeklggkalgvdidpmvlpqaeanakrngvrprflegsleaalpfgpfd
    llvanlyaelhaalapryrealvpggralltgilkdraplvreamagagfrpleeaaege
    wvllaygr