PDB entry 1ufi

View 1ufi on RCSB PDB site
Description: Crystal structure of the dimerization domain of human CENP-B
Deposited on 2003-05-30, released 2004-02-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.236
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ufia_
  • Chain 'B':
    Domains in SCOP 1.69: d1ufib_
  • Chain 'C':
    Domains in SCOP 1.69: d1ufic_
  • Chain 'D':
    Domains in SCOP 1.69: d1ufid_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufiA (A:)
    gshmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrknharqagvrgl
    ghqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufiA (A:)
    hmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ufiB (B:)
    gshmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrknharqagvrgl
    ghqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufiB (B:)
    pvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrkn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ufiC (C:)
    gshmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrknharqagvrgl
    ghqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufiC (C:)
    shmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ufiD (D:)
    gshmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrknharqagvrgl
    ghqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufiD (D:)
    hmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtr