PDB entry 1ufi

View 1ufi on RCSB PDB site
Description: Crystal structure of the dimerization domain of human CENP-B
Class: DNA binding protein
Keywords: dimerization domain, salt bridge, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
Deposited on 2003-05-30, released 2004-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.236
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major centromere autoantigen b
    Species: Homo sapiens [TaxId:9606]
    Gene: CENPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07199 (4-End)
      • cloning artifact (2-3)
    Domains in SCOPe 2.07: d1ufia1, d1ufia2
  • Chain 'B':
    Compound: major centromere autoantigen b
    Species: Homo sapiens [TaxId:9606]
    Gene: CENPB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufib_
  • Chain 'C':
    Compound: major centromere autoantigen b
    Species: Homo sapiens [TaxId:9606]
    Gene: CENPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07199 (4-End)
      • cloning artifact (1-3)
    Domains in SCOPe 2.07: d1ufic1, d1ufic2
  • Chain 'D':
    Compound: major centromere autoantigen b
    Species: Homo sapiens [TaxId:9606]
    Gene: CENPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07199 (4-End)
      • cloning artifact (2-3)
    Domains in SCOPe 2.07: d1ufid1, d1ufid2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufiA (A:)
    gshmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrknharqagvrgl
    ghqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufiA (A:)
    hmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ufiB (B:)
    gshmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrknharqagvrgl
    ghqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufiB (B:)
    pvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrkn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ufiC (C:)
    gshmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrknharqagvrgl
    ghqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufiC (C:)
    shmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ufiD (D:)
    gshmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtrknharqagvrgl
    ghqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufiD (D:)
    hmpvpsfgeamayfamvkryltsfpiddrvqshilhlehdlvhvtr