PDB entry 1ufh

View 1ufh on RCSB PDB site
Description: Structure of putative acetyltransferase, YYCN protein of Bacillus subtilis
Class: structural genomics, unknown function
Keywords: alpha and beta, fold, acetyltransferase, bacillus subtilis, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2003-05-29, released 2003-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YycN protein
    Species: Bacillus subtilis [TaxId:224308]
    Gene: YYCN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufha_
  • Chain 'B':
    Compound: YycN protein
    Species: Bacillus subtilis [TaxId:224308]
    Gene: YYCN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufhA (A:)
    mhhhhhhssgvdlgtenlyfqsnamtimltpmqteefrsyltyttkhyaeekvkagtwlp
    edaqllskqvftdllprgletphhhlwslklnekdivgwlwihaepehpqqeafiydfgl
    yepyrgkgyakqalaaldqaarsmgirklslhvfahnqtarklyeqtgfqetdvvmskkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufhA (A:)
    timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
    lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
    irklslhvfahnqtarklyeqtgfqetdvvmskkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ufhB (B:)
    mhhhhhhssgvdlgtenlyfqsnamtimltpmqteefrsyltyttkhyaeekvkagtwlp
    edaqllskqvftdllprgletphhhlwslklnekdivgwlwihaepehpqqeafiydfgl
    yepyrgkgyakqalaaldqaarsmgirklslhvfahnqtarklyeqtgfqetdvvmskkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufhB (B:)
    imltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhhl
    wslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmgi
    rklslhvfahnqtarklyeqtgfqetdvvmskkl