PDB entry 1ufg

View 1ufg on RCSB PDB site
Description: solution structure of immunoglobulin like domain of mouse nuclear lamin
Deposited on 2003-05-29, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ufga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ufgA (A:)
gssgssgqsqgggsvtkkrklessesrssfsqhartsgrvaveevdeegkfvrlrnksne
dqsmgnwqirrqngddplmtyrfppkftlkagqvvtiwasgagathspptdlvwkaqntw
gcgsslrtalinstgeevamrklvrsgpssg