PDB entry 1ufg

View 1ufg on RCSB PDB site
Description: Solution structure of immunoglobulin like domain of mouse nuclear lamin
Class: structural protein
Keywords: immunoglobulin like fold, nuclear lamin, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2003-05-29, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lamin A
    Species: Mus musculus [TaxId:10090]
    Gene: RIKEN cDNA 1200006N04
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48678 (7-144)
      • cloning artifact (0-6)
      • cloning artifact (145-150)
    Domains in SCOPe 2.08: d1ufga1, d1ufga2, d1ufga3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufgA (A:)
    gssgssgqsqgggsvtkkrklessesrssfsqhartsgrvaveevdeegkfvrlrnksne
    dqsmgnwqirrqngddplmtyrfppkftlkagqvvtiwasgagathspptdlvwkaqntw
    gcgsslrtalinstgeevamrklvrsgpssg