PDB entry 1uff

View 1uff on RCSB PDB site
Description: Solution structure of the first SH3 domain of human intersectin2 (KIAA1256)
Class: endocytosis/exocytosis
Keywords: Beta barrel, SH3 domain, endocytosis, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2003-05-29, released 2003-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intersectin 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA hh15293
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZM3 (7-87)
      • cloning artifact (0-6)
      • cloning artifact (88-92)
    Domains in SCOPe 2.07: d1uffa1, d1uffa2, d1uffa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uffA (A:)
    gssgssgyralypfearnhdemsfnsgdiiqvdektvgepgwlygsfqgnfgwfpcnyve
    kmpssenekavspkkallpptvslsatsgpssg