PDB entry 1ufb

View 1ufb on RCSB PDB site
Description: Crystal structure of TT1696 from Thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-05-28, released 2003-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TT1696 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufba_
  • Chain 'B':
    Compound: TT1696 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufbb_
  • Chain 'C':
    Compound: TT1696 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufbc_
  • Chain 'D':
    Compound: TT1696 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ufbd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufbA (A:)
    mnrardwleqarhnlrhaqgslglgdyawacfaaqqaaeaalkglhlargqvawghsild
    lladlpedvdvpedlveaakvldkyyiptrypdahpagpaarhytrleaeealdlaqkil
    afveekl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufbB (B:)
    mnrardwleqarhnlrhaqgslglgdyawacfaaqqaaeaalkglhlargqvawghsild
    lladlpedvdvpedlveaakvldkyyiptrypdahpagpaarhytrleaeealdlaqkil
    afveekl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufbC (C:)
    mnrardwleqarhnlrhaqgslglgdyawacfaaqqaaeaalkglhlargqvawghsild
    lladlpedvdvpedlveaakvldkyyiptrypdahpagpaarhytrleaeealdlaqkil
    afveekl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ufbD (D:)
    mnrardwleqarhnlrhaqgslglgdyawacfaaqqaaeaalkglhlargqvawghsild
    lladlpedvdvpedlveaakvldkyyiptrypdahpagpaarhytrleaeealdlaqkil
    afveekl