PDB entry 1ufa

View 1ufa on RCSB PDB site
Description: crystal structure of tt1467 from thermus thermophilus hb8
Deposited on 2003-05-28, released 2003-11-28
The last revision prior to the SCOP 1.71 freeze date was dated 2003-11-28, with a file datestamp of 2003-11-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.187
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ufaA (A:)
    marfalvlhahlpyvrahgmwpfgeetlyeamaetylplirvlerlraegveapftlgit
    pilaeqladarikegfwayakdrleraqgdyqryrgtaleasarhqvafweltldhfqrl
    sgdlvaafrkaeeggqvelitsnathgyspllgydealwaqiktgvstyrrhfakdptgf
    wlpemayrpkgpwkppvegppegvrpgvdellmragirytfvdahlvqggeplspygeaa
    lgpvesqeatyhvhelesglrvlarnpettlqvwsadygypgeglyrefhrkdplsglhh
    wrvthrkadlaekapydpeaafakteeharhfvgllerlagrhpegvilspydaelfghw
    wyegvawleavlrllaqnpkvrpvtareavqgpavrtalpegswgrggdhrvwlnektld
    ywekvyraegamreaarrgvlpegvlrqamrelllleasdwpflmetgqaeayareryee
    haraffhllkgaspeelraleerdnpfpeadprlylfrea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ufaA (A:)
    marfalvlhahlpyvrahgmwpfgeetlyeamaetylplirvlerlraegveapftlgit
    pilaeqladarikegfwayakdrleraqgdyqryrgtaleasarhqvafweltldhfqrl
    sgdlvaafrkaeeggqvelitsnathgyspllgydealwaqiktgvstyrrhfakdptgf
    wlpemayrpkgpwkppvegppegvrpgvdellmragirytfvdahlvqggeplspvesqe
    atyhvhelesglrvlarnpettlqvwsadygypgeglyrefhrkdplsglhhwrvthrka
    dlaekapydpeaafakteeharhfvgllerlagrhpegvilspydaelfghwwyegvawl
    eavlrllaqnpkvrpvtareavqgpavrtalpegswgrggdhrvwlnektldywekvyra
    egamreaarrgvlpegvlrqamrelllleasdwpflmetgqaeayareryeeharaffhl
    lkgaspeelraleerdnpfpeadprlylf