PDB entry 1uf9

View 1uf9 on RCSB PDB site
Description: Crystal structure of TT1252 from Thermus thermophilus
Class: structural genomics, unknown function
Keywords: p-loop, nucleotide binding domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-05-28, released 2003-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.222
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: TT1252 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uf9a_
  • Chain 'B':
    Compound: TT1252 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uf9b_
  • Chain 'C':
    Compound: TT1252 protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uf9c_
  • Heterogens: PO4, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uf9A (A:)
    mgheakhpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpea
    vvggrldrralarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekg
    wegrlhgtllvaapleervrrvmarsglsreevlareraqmpeeekrkratwvlentgsl
    edleralkavlaeltggategrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uf9A (A:)
    khpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpeavvggr
    ldrralarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekgwegrl
    hgtllvaapleervrrvmarsglsreevlareraqmpeeekrkratwvlentgsledler
    alkavlaeltg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uf9B (B:)
    mgheakhpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpea
    vvggrldrralarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekg
    wegrlhgtllvaapleervrrvmarsglsreevlareraqmpeeekrkratwvlentgsl
    edleralkavlaeltggategrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uf9B (B:)
    khpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpeavvggr
    ldrralarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekgwegrl
    hgtllvaapleervrrvmarsglsreevlareraqmpeeekrkratwvlentgsledler
    alkavlaeltg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uf9C (C:)
    mgheakhpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpea
    vvggrldrralarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekg
    wegrlhgtllvaapleervrrvmarsglsreevlareraqmpeeekrkratwvlentgsl
    edleralkavlaeltggategrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uf9C (C:)
    khpiiigitgnigsgkstvaallrswgypvldldalaararenkeeelkrlfpeavvggr
    ldrralarlvfsdperlkaleavvhpevrrllmeelsrleaplvfleipllfekgwegrl
    hgtllvaapleervrrvmarsglsreevlareraqmpeeekrkratwvlentgsledler
    alkavlaeltg