PDB entry 1uf8

View 1uf8 on RCSB PDB site
Description: Crystal structure of C171A/V236A Mutant of N-carbamyl-D-amino acid amidohydrolase complexed with N-carbamyl-D-Phenylalanine
Class: hydrolase
Keywords: hydrolase, N-CARBAMYL-D-AMINO ACID AMIDOHYDROLASE, D-AMINO ACID, N-carbamyl-D-phenylalanine
Deposited on 2003-05-26, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.202
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-carbamyl-D-amino acid amidohydrolase
    Species: Agrobacterium sp. [TaxId:361]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60327 (0-302)
      • engineered (170)
      • engineered (235)
    Domains in SCOPe 2.07: d1uf8a_
  • Chain 'B':
    Compound: N-carbamyl-D-amino acid amidohydrolase
    Species: Agrobacterium sp. [TaxId:361]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60327 (0-302)
      • engineered (170)
      • engineered (235)
    Domains in SCOPe 2.07: d1uf8b_
  • Heterogens: ING, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf8A (A:)
    trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
    eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
    vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmfiandrrwpeaw
    rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkagmee
    ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
    ael
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf8B (B:)
    trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
    eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
    vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmfiandrrwpeaw
    rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkagmee
    ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
    ael