PDB entry 1uf6

View 1uf6 on RCSB PDB site
Description: Crystal structure of the conserved hypothetical protein TT1927b from Thermus thermophilus HB8
Class: lipid binding protein
Keywords: beta-barrel, structural genomics
Deposited on 2003-05-26, released 2003-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-12-21, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.234
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein TT1927b
    Species: Thermus thermophilus
    Domains in SCOPe 2.07: d1uf6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uf6A (A:)
    mkwnldpshtsidfkvrhmgiasvrgslkvlsgsvetdeagrpiqveavidaasiatgep
    qrdghlrsadflhaeqypeirfvstqieplggnryriqgnltirditkpvtleaevsapi
    kdpwgmqrvaasasgqinrkdwnltwnqvlelgallvgeevkfnleveavapapvaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uf6A (A:)
    mkwnldpshtsidfkvrhmgiasvrgslkvlsgsvetdeagrpiqveavidaasiatgep
    qrdghlrsadflhaeqypeirfvstqieplggnryriqgnltirditkpvtleaevsapi
    kdpwgmqrvaasasgqinrkdwnltwnqvlelgallvgeevkfnleveavapapva