PDB entry 1uf5

View 1uf5 on RCSB PDB site
Description: Crystal structure of C171A/V236A Mutant of N-carbamyl-D-amino acid amidohydrolase complexed with N-carbamyl-D-methionine
Class: hydrolase
Keywords: hydrolase
Deposited on 2003-05-23, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.178
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-carbamyl-D-amino acid amidohydrolase
    Species: Agrobacterium sp. [TaxId:361]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60327 (0-302)
      • engineered (170)
      • engineered (235)
    Domains in SCOPe 2.07: d1uf5a_
  • Chain 'B':
    Compound: N-carbamyl-D-amino acid amidohydrolase
    Species: Agrobacterium sp. [TaxId:361]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60327 (0-302)
      • engineered (170)
      • engineered (235)
    Domains in SCOPe 2.07: d1uf5b_
  • Heterogens: CDT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf5A (A:)
    trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
    eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
    vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmfiandrrwpeaw
    rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkagmee
    ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
    ael
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf5B (B:)
    trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
    eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
    vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmfiandrrwpeaw
    rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkagmee
    ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
    ael