PDB entry 1uf4

View 1uf4 on RCSB PDB site
Description: Crystal structure of C171A/V236A Mutant of N-carbamyl-D-amino acid amidohydrolase
Class: hydrolase
Keywords: N-carbamyl-D-amino acid amidohydrolase, D-amino acid
Deposited on 2003-05-23, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.201
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-carbamyl-D-amino acid amidohydrolase
    Species: Agrobacterium sp. [TaxId:361]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60327 (0-302)
      • engineered (170)
      • engineered (235)
    Domains in SCOPe 2.07: d1uf4a_
  • Chain 'B':
    Compound: N-carbamyl-D-amino acid amidohydrolase
    Species: Agrobacterium sp. [TaxId:361]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60327 (0-302)
      • engineered (170)
      • engineered (235)
    Domains in SCOPe 2.07: d1uf4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf4A (A:)
    trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
    eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
    vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmfiandrrwpeaw
    rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkagmee
    ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
    ael
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf4B (B:)
    trqmilavgqqgpiaraetreqvvvrlldmltkaasrganfivfpelalttffprwhftd
    eaeldsfyetempgpvvrplfekaaelgigfnlgyaelvveggvkrrfntsilvdksgki
    vgkyrkihlpghkeyeayrpfqhlekryfepgdlgfpvydvdaakmgmfiandrrwpeaw
    rvmglrgaeiicggyntpthnppvpqhdhltsfhhllsmqagsyqngawsaaagkagmee
    ncmllghscivaptgeivaltttledevitaavdldrcrelrehifnfkqhrqpqhygli
    ael