PDB entry 1uf3

View 1uf3 on RCSB PDB site
Description: Crystal structure of TT1561 of thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Metallo-dependent phosphatases, Thermus thermophilus, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2003-05-23, released 2003-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TT1561
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uf3a_
  • Chain 'B':
    Compound: hypothetical protein TT1561
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uf3b_
  • Chain 'C':
    Compound: hypothetical protein TT1561
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uf3c_
  • Chain 'D':
    Compound: hypothetical protein TT1561
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uf3d_
  • Chain 'E':
    Compound: hypothetical protein TT1561
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uf3e_
  • Chain 'F':
    Compound: hypothetical protein TT1561
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uf3f_
  • Chain 'G':
    Compound: hypothetical protein TT1561
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uf3g_
  • Chain 'H':
    Compound: hypothetical protein TT1561
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uf3h_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf3A (A:)
    mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrils
    eahlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiade
    gepeehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthn
    pllvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uf3B (B:)
    mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrils
    eahlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiade
    gepeehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthn
    pllvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uf3B (B:)
    rtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrilsea
    hlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiadege
    peehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthnpl
    lvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uf3C (C:)
    mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrils
    eahlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiade
    gepeehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthn
    pllvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uf3C (C:)
    tvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrilseah
    lptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiadegep
    eehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthnpll
    vlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf3D (D:)
    mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrils
    eahlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiade
    gepeehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthn
    pllvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf3E (E:)
    mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrils
    eahlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiade
    gepeehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthn
    pllvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf3F (F:)
    mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrils
    eahlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiade
    gepeehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthn
    pllvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf3G (G:)
    mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrils
    eahlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiade
    gepeehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthn
    pllvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uf3H (H:)
    mrrtvryilatsnpmgdlealekfvklapdtgadaialignlmpkaaksrdyaaffrils
    eahlptayvpgpqdapiweylreaanvelvhpemrnvhetftfwrgpylvagvggeiade
    gepeehealrypawvaeyrlkalwelkdypkiflfhtmpyhkglneqgshevahlikthn
    pllvlvagkgqkhemlgaswvvvpgdlsegeyslldlrarkletgnvr