PDB entry 1uf0

View 1uf0 on RCSB PDB site
Description: Solution structure of the N-terminal DCX domain of human doublecortin-like kinase
Class: transferase
Keywords: structural genomics, ubiquitin-like fold, microtubule-binding, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2003-05-22, released 2003-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase DCAMKL1
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA hh00177
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15075 (7-109)
      • cloning artifact (0-6)
      • cloning artifact (110-115)
    Domains in SCOPe 2.08: d1uf0a1, d1uf0a2, d1uf0a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uf0A (A:)
gssgssgkkakkvrfyrngdryfkgivyaispdrfrsfealladltrtlsdnvnlpqgvr
tiytidglkkissldqlvegesyvcgsiepfkkleytknvnpnwsvnvktsgpssg