PDB entry 1uez

View 1uez on RCSB PDB site
Description: Solution structure of the first PDZ domain of human KIAA1526 protein
Class: protein binding
Keywords: PDZ domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2003-05-22, released 2003-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1526 Protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA fj04743
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P202 (7-94)
      • cloning artifact (0-6)
      • cloning artifact (95-100)
    Domains in SCOPe 2.08: d1ueza1, d1ueza2, d1ueza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uezA (A:)
    gssgssgevrlvslrrakaheglgfsirggsehgvgiyvslvepgslaekeglrvgdqil
    rvndkslarvthaeavkalkgskklvlsvysagrisgpssg