PDB entry 1uew

View 1uew on RCSB PDB site
Description: Solution Structure of The forth PDZ Domain of Human Atrophin-1 Interacting Protein 1 (KIAA0705 Protein)
Class: signaling protein
Keywords: Atrophin-1 Interacting Protein 1, PDZ Domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-05-22, released 2003-11-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: membrane associated guanylate kinase inverted-2 (magi-2)
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hg03359
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86UL8 (7-107)
      • cloning artifact (0-6)
      • cloning artifact (108-113)
    Domains in SCOPe 2.08: d1uewa1, d1uewa2, d1uewa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uewA (A:)
gssgssgslqtsdvvihrkenegfgfviisslnrpesgstitvphkigriidgspadrca
klkvgdrilavngqsiinmphadivklikdaglsvtlriipqeelnspsgpssg