PDB entry 1ueu

View 1ueu on RCSB PDB site
Description: Divergent evolutions of trinucleotide polymerization revealed by an archaeal CCA-adding enzyme structure
Class: transferase
Keywords: transferase, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-05-21, released 2003-12-02
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA nucleotidyltransferase
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ueua1, d1ueua2, d1ueua3
  • Heterogens: ACT, MG, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ueuA (A:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ueuA (A:)
    kveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgsleid
    vfllfpeefskeelrergleigkavldsyehpyvhgvvkgvevdvvpcyklkepkniksa
    vdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcellivfygsfl
    etvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefm
    eapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkife
    flerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafr
    pfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvt
    aelcemmgvkd