PDB entry 1ueu

View 1ueu on RCSB PDB site
Description:
Deposited on 2003-05-21, released 2003-12-02
The last revision prior to the SCOP 1.71 freeze date was dated 2003-12-02, with a file datestamp of 2003-12-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ueuA (A:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ueuA (A:)
    kveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgsleid
    vfllfpeefskeelrergleigkavldsyehpyvhgvvkgvevdvvpcyklkepkniksa
    vdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcellivfygsfl
    etvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefm
    eapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkife
    flerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafr
    pfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvt
    aelcemmgvkd