PDB entry 1uet

View 1uet on RCSB PDB site
Description: Divergent evolutions of trinucleotide polymerization revealed by an archaeal CCA-adding enzyme structure
Deposited on 2003-05-21, released 2003-12-02
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-02, with a file datestamp of 2003-12-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uetA (A:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uetA (A:)
    kveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgsleid
    vfllfpeefskeelrergleigkavldehpyvhgvvkgvevdvvpcyklkepkniksavd
    rtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcellivfygsflet
    vknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvhlcrefmea
    pslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifefl
    erenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpf
    iengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtae
    lcemmgvkd