PDB entry 1uer

View 1uer on RCSB PDB site
Description: Crystal structure of Porphyromonas gingivalis SOD
Class: oxidoreductase
Keywords: metal-specific, cambialistic, superoxide dismutase, SOD, oxidoreductase
Deposited on 2003-05-20, released 2004-05-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.231
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Porphyromonas gingivalis [TaxId:837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uera1, d1uera2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Porphyromonas gingivalis [TaxId:837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uerb1, d1uerb2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Porphyromonas gingivalis [TaxId:837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uerc1, d1uerc2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Porphyromonas gingivalis [TaxId:837]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uerd1, d1uerd2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uerA (A:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uerB (B:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uerC (C:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uerD (D:)
    mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
    eggifnnagqtlnhnlyftqfrpgkggapkgklgeaidkqfgsfekfkeefntagttlfg
    sgwvwlasdangklsiekepnagnpvrkglnpllgfdvwehayyltyqnrradhlkdlws
    ivdwdivesry