PDB entry 1uep

View 1uep on RCSB PDB site
Description: Solution Structure of The Third PDZ Domain of Human Atrophin-1 Interacting Protein 1 (KIAA0705 Protein)
Class: signaling protein
Keywords: ATROPHIN-1 INTERACTING PROTEIN 1, PDZ Domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2003-05-20, released 2003-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: membrane associated guanylate kinase inverted-2 (magi-2)
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hg03359
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86UL8 (7-96)
      • cloning artifact (0-6)
      • cloning artifact (97-102)
    Domains in SCOPe 2.08: d1uepa1, d1uepa2, d1uepa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uepA (A:)
    gssgssgykeldvhlrrmesgfgfrilggdepgqpiligaviamgsadrdgrlhpgdelv
    yvdgipvagkthryvidlmhhaarngqvnltvrrkvlsgpssg