PDB entry 1ueo

View 1ueo on RCSB PDB site
Description: solution structure of the [t8a]-penaeidin-3
Deposited on 2003-05-20, released 2003-10-21
The last revision prior to the SCOP 1.67 freeze date was dated 2003-10-21, with a file datestamp of 2003-10-21.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ueoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ueoA (A:)
    qvykggyarpiprpppfvrplpggpigpyngcpvscrgisfsqarsccsrlgrcchvgkg
    ysg