PDB entry 1ueo

View 1ueo on RCSB PDB site
Description: Solution structure of the [T8A]-Penaeidin-3
Class: antibiotic
Keywords: helix, coil-helix-coil, proline-rich, cysteine-rich, disulfide bond, ANTIBIOTIC
Deposited on 2003-05-20, released 2003-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Penaeidin-3a
  Species: Litopenaeus vannamei [TaxId:6689]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81058 (0-62)
    • engineered (7)
  Domains in SCOPe 2.08: d1ueoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ueoA (A:)
  qvykggyarpiprpppfvrplpggpigpyngcpvscrgisfsqarsccsrlgrcchvgkg
  ysg