PDB entry 1uen

View 1uen on RCSB PDB site
Description: Solution Structure of The Third Fibronectin III Domain of Human KIAA0343 Protein
Class: cell adhesion
Keywords: Immunoglobulin-like Beta-Sandwich Fold, Fibronectin Type III, NG-CAM Related Cell Adhesion Molecule, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2003-05-19, released 2003-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA0343 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA hg01457
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92823 (7-118)
      • cloning artifact (0-6)
      • cloning artifact (119-124)
    Domains in SCOPe 2.08: d1uena1, d1uena2, d1uena3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uenA (A:)
    gssgssghsgedlpmvapgnvrvnvvnstlaevhwdpvplksirghlqgyriyywktqss
    skrnrrhiekkiltfqgskthgmlpglepfshytlnvrvvngkgegpaspdrvfntpegs
    gpssg