PDB entry 1uem

View 1uem on RCSB PDB site
Description: solution structure of the first fibronectin type iii domain of human kiaa1568 protein
Deposited on 2003-05-19, released 2003-11-19
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-19, with a file datestamp of 2003-11-19.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1uema_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1uemA (A:)
  gssgssgknydlsdlpgppskpqvtdvtknsvtlswqpgtpgtlpasayiieafsqsvsn
  swqtvanhvkttlytvrglrpntiylfmvrainpqglsdpspmsdpvrtqdsgpssg