PDB entry 1uem

View 1uem on RCSB PDB site
Description: Solution Structure of the First Fibronectin Type III domain of human KIAA1568 Protein
Class: structural genomics, unknown function
Keywords: Immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, unknown function
Deposited on 2003-05-19, released 2003-11-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA1568 Protein
    Species: Homo sapiens [TaxId:9606]
    Gene: KAZUSA cDNA fh22308
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HCK4 (7-110)
      • cloning artifact (0-6)
      • cloning artifact (111-116)
    Domains in SCOPe 2.07: d1uema1, d1uema2, d1uema3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uemA (A:)
    gssgssgknydlsdlpgppskpqvtdvtknsvtlswqpgtpgtlpasayiieafsqsvsn
    swqtvanhvkttlytvrglrpntiylfmvrainpqglsdpspmsdpvrtqdsgpssg