PDB entry 1uel

View 1uel on RCSB PDB site
Description: solution structure of ubiquitin-like domain of hhr23b complexed with ubiquitin-interacting motif of proteasome subunit s5a
Deposited on 2003-05-19, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1uela_
  • Chain 'B':
    Domains in SCOP 1.67: d1uelb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uelA (A:)
mqvtlktlqqqtfkididpeetvkalkekiesekgkdafpvagqkliyagkilnddtalk
eykideknfvvvmvtkpkavstpapatlehhhhhh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1uelB (B:)
gshmtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesad