PDB entry 1uek

View 1uek on RCSB PDB site
Description: Crystal structure of 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase
Deposited on 2003-05-17, released 2003-06-17
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-19, with a file datestamp of 2003-08-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.184
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uekA (A:)
    merlapakvnlglsvrfrredgyhelhtlfapfsladrlvvepvssglhfqgpygrenla
    yraaslyleaagqpggvrillekripegaglgggssdaaqvllalqalypaevdlfalar
    tlgadvpffllgrgaeargvgerlkplalppvpavvffpglrvptplvyravrpedfgpd
    lpveailealargeeppywnslegpafrlfpelkevrgrmralglrgvlmsgsgsaffgl
    aegpdharraaealrawgrawagtlgggdagsgpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uekA (A:)
    merlapakvnlglsvrfrredgyhelhtlfapfsladrlvvepvssglhfqgpygrenla
    yraaslyleaagqpggvrillekripegaglgggssdaaqvllalqalypaevdlfalar
    tlgadvpffllgrgaeargvgerlkplalppvpavvffpglrvptplvyravrpedfgpd
    lpveailealargeeppywnslegpafrlfpelkevrgrmralglrgvlmsgsgsaffgl
    aegpdharraaealrawgrawagtlggg