PDB entry 1ueg

View 1ueg on RCSB PDB site
Description: Crystal structure of amino-terminal microtubule binding domain of EB1
Class: structural protein
Keywords: CH domain, STRUCTURAL PROTEIN
Deposited on 2003-05-14, released 2003-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.223
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Microtubule-associated protein RP/EB family member 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EB1 (amino acids 1-130)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uega_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uegA (A:)
    mavnvystsvtsdnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkk
    vkfqakleheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanyd
    gkdydpvaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uegA (A:)
    avnvysnlsrhdmlawineslqlnltkieqlcsgaaycqfmdmlfpgsialkkvkfqakl
    eheyiqnfkilqagfkrmgvdkiipvdklvkgkfqdnfefvqwfkkffdanydgkvaar