PDB entry 1uef

View 1uef on RCSB PDB site
Description: Crystal Structure of Dok1 PTB Domain Complex
Class: protein binding/transferase
Keywords: protein binding, transferase, phosphotyrosine binding domain, PROTEIN BINDING/TRANSFERASE COMPLEX
Deposited on 2003-05-14, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Docking protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P97465 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d1uefa1, d1uefa2
  • Chain 'B':
    Compound: Docking protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uefb_
  • Chain 'C':
    Compound: 13-mer peptide from Proto-oncogene tyrosine-protein kinase receptor ret
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 13-mer peptide from Proto-oncogene tyrosine-protein kinase receptor ret
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uefA (A:)
    gshmgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllr
    rygrdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaqgkvgqaqdilrl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uefA (A:)
    mgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrryg
    rdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uefB (B:)
    gshmgsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllr
    rygrdkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqkaqgkvgqaqdilrl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uefB (B:)
    gsqfwvtsqkteasercglqgsyilrveaekltlltlgaqsqilepllfwpytllrrygr
    dkvmfsfeagrrcpsgpgtftfqtsqgndifqaveaaiqqqka
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.