PDB entry 1ued

View 1ued on RCSB PDB site
Description: Crystal Structure of OxyC a Cytochrome P450 Implicated in an Oxidative C-C Coupling Reaction During Vancomycin Biosynthesis.
Deposited on 2003-05-11, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ueda_
  • Chain 'B':
    Domains in SCOP 1.67: d1uedb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uedA (A:)
    mghdidqvapllrepanfqlrtncdphednfglrahgplvrivgesstqlgrdfvwqahg
    yevvrrilgdhehfttrpqftqsksgahveaqfvgqistydppehtrlrkmltpeftvrr
    irrmepaiqsliddrldlleaegpsadlqglfadpvgahalcellgiprddqrefvrrir
    rnadlsrglkaraadsaafnryldnllarqradpddgllgmivrdhgdnvtdeelkglct
    alilggvetvagmigfgvlalldnpgqiellfespekaervvnelvrylspvqapnprla
    ikdvvidgqlikagdyvlcsilmanrdealtpdpdvldanraavsdvgfghgihycvgaa
    larsmlrmayqtlwrrfpglrlavpieevkyrsafvdcpdqvpvtw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uedA (A:)
    didqvapllrepanfqlrtncdphednfglrahgplvrivgesstqlgrdfvwqahgyev
    vrrilgdhehfttrpqfeaqfvgqistydppehtrlrkmltpeftvrrirrmepaiqsli
    ddrldlleaegpsadlqglfadpvgahalcellgiprddqrefvrrirrnarglkaraad
    saafnryldnllarqradpddgllgmivrdhgdnvtdeelkglctalilggvetvagmig
    fgvlalldnpgqiellfespekaervvnelvrylspvqapnprlaikdvvidgqlikagd
    yvlcsilmanrdealtpdpdvldanraavsdvgfghgihycvgaalarsmlrmayqtlwr
    rfpglrlavpieevkyrsafvdcpdqvpvtw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uedB (B:)
    mghdidqvapllrepanfqlrtncdphednfglrahgplvrivgesstqlgrdfvwqahg
    yevvrrilgdhehfttrpqftqsksgahveaqfvgqistydppehtrlrkmltpeftvrr
    irrmepaiqsliddrldlleaegpsadlqglfadpvgahalcellgiprddqrefvrrir
    rnadlsrglkaraadsaafnryldnllarqradpddgllgmivrdhgdnvtdeelkglct
    alilggvetvagmigfgvlalldnpgqiellfespekaervvnelvrylspvqapnprla
    ikdvvidgqlikagdyvlcsilmanrdealtpdpdvldanraavsdvgfghgihycvgaa
    larsmlrmayqtlwrrfpglrlavpieevkyrsafvdcpdqvpvtw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uedB (B:)
    ghdidqvapllrepanfqlrtncdphednfglrahgplvrivgesstqlgrdfvwqahgy
    evvrrilgdhehfttrpaqfvgqistydppehtrlrkmltpeftvrrirrmepaiqslid
    drldlleaegpsadlqglfadpvgahalcellgiprddqrefvrrirrnasrglkaraad
    saafnryldnllarqradpddgllgmivrdhgdnvtdeelkglctalilggvetvagmig
    fgvlalldnpgqiellfespekaervvnelvrylspvqapnprlaikdvvidgqlikagd
    yvlcsilmanrdealtpdpdvldanraavsdvgfghgihycvgaalarsmlrmayqtlwr
    rfpglrlavpieevkyrsafvdcpdqvpvtw