PDB entry 1ued

View 1ued on RCSB PDB site
Description: Crystal Structure of OxyC a Cytochrome P450 Implicated in an Oxidative C-C Coupling Reaction During Vancomycin Biosynthesis.
Class: oxidoreductase
Keywords: Cytochrome P450 vancomycin biosynthesis, OXIDOREDUCTASE
Deposited on 2003-05-11, released 2003-12-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: P450 monooxygenase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ueda_
  • Chain 'B':
    Compound: P450 monooxygenase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1uedb_
  • Heterogens: HEM, PG4, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uedA (A:)
    mghdidqvapllrepanfqlrtncdphednfglrahgplvrivgesstqlgrdfvwqahg
    yevvrrilgdhehfttrpqftqsksgahveaqfvgqistydppehtrlrkmltpeftvrr
    irrmepaiqsliddrldlleaegpsadlqglfadpvgahalcellgiprddqrefvrrir
    rnadlsrglkaraadsaafnryldnllarqradpddgllgmivrdhgdnvtdeelkglct
    alilggvetvagmigfgvlalldnpgqiellfespekaervvnelvrylspvqapnprla
    ikdvvidgqlikagdyvlcsilmanrdealtpdpdvldanraavsdvgfghgihycvgaa
    larsmlrmayqtlwrrfpglrlavpieevkyrsafvdcpdqvpvtw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uedA (A:)
    didqvapllrepanfqlrtncdphednfglrahgplvrivgesstqlgrdfvwqahgyev
    vrrilgdhehfttrpqfeaqfvgqistydppehtrlrkmltpeftvrrirrmepaiqsli
    ddrldlleaegpsadlqglfadpvgahalcellgiprddqrefvrrirrnarglkaraad
    saafnryldnllarqradpddgllgmivrdhgdnvtdeelkglctalilggvetvagmig
    fgvlalldnpgqiellfespekaervvnelvrylspvqapnprlaikdvvidgqlikagd
    yvlcsilmanrdealtpdpdvldanraavsdvgfghgihycvgaalarsmlrmayqtlwr
    rfpglrlavpieevkyrsafvdcpdqvpvtw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uedB (B:)
    mghdidqvapllrepanfqlrtncdphednfglrahgplvrivgesstqlgrdfvwqahg
    yevvrrilgdhehfttrpqftqsksgahveaqfvgqistydppehtrlrkmltpeftvrr
    irrmepaiqsliddrldlleaegpsadlqglfadpvgahalcellgiprddqrefvrrir
    rnadlsrglkaraadsaafnryldnllarqradpddgllgmivrdhgdnvtdeelkglct
    alilggvetvagmigfgvlalldnpgqiellfespekaervvnelvrylspvqapnprla
    ikdvvidgqlikagdyvlcsilmanrdealtpdpdvldanraavsdvgfghgihycvgaa
    larsmlrmayqtlwrrfpglrlavpieevkyrsafvdcpdqvpvtw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uedB (B:)
    ghdidqvapllrepanfqlrtncdphednfglrahgplvrivgesstqlgrdfvwqahgy
    evvrrilgdhehfttrpaqfvgqistydppehtrlrkmltpeftvrrirrmepaiqslid
    drldlleaegpsadlqglfadpvgahalcellgiprddqrefvrrirrnasrglkaraad
    saafnryldnllarqradpddgllgmivrdhgdnvtdeelkglctalilggvetvagmig
    fgvlalldnpgqiellfespekaervvnelvrylspvqapnprlaikdvvidgqlikagd
    yvlcsilmanrdealtpdpdvldanraavsdvgfghgihycvgaalarsmlrmayqtlwr
    rfpglrlavpieevkyrsafvdcpdqvpvtw