PDB entry 1uec

View 1uec on RCSB PDB site
Description: Crystal structure of autoinhibited form of tandem SH3 domain of p47phox
Class: signaling protein
Keywords: NADPH oxidase, p47phox, phagocyte, SH3 domain, autoinhibition, SIGNALING PROTEIN
Deposited on 2003-05-11, released 2003-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.213
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ueca1, d1ueca2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uecA (A:)
    gamditgpiilqtyraiadyektsgsemalstgdvvevveksesgwwfcqmkakrgwipa
    sflepldspdetedpepnyagepyvaikaytavegdevsllegeavevihklldgwwvir
    kddvtgyfpsmylqksgqdvsqaqrqikrgapprrssirnahsihqrsrkrlsqdayrrn
    svrflqqrrrqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uecA (A:)
    ilqtyraiadyeksemalstgdvvevveksesgwwfcqmkakrgwipasflepldspdet
    edpepnyagepyvaikaytavegdevsllegeavevihklldgwwvirkddvtgyfpsmy
    lqksgqdvsqaqrqikrgapprrssirnahsihqrsrkrlsqdayrrnsvrflqqrr