PDB entry 1ueb

View 1ueb on RCSB PDB site
Description: Crystal structure of translation elongation factor P from Thermus thermophilus HB8
Class: RNA binding protein
Keywords: Beta barrel, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA BINDING PROTEIN
Deposited on 2003-05-09, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.213
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor P
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ueba1, d1ueba2, d1ueba3
  • Chain 'B':
    Compound: elongation factor P
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uebb1, d1uebb2, d1uebb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1uebA (A:)
    misvtdlrpgtkvkmdgglwecveyqhqklgrggakvvakfknletgatvertfnsgekl
    ediyvetrelqylypegeemvfmdletyeqfavprsrvvgaeffkegmtalgdmyegqpi
    kvtpptvvelkvvdtppgvrgdtvsggskpatletgavvqvplfvepgevikvdtrtgey
    vgra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uebB (B:)
    misvtdlrpgtkvkmdgglwecveyqhqklgrggakvvakfknletgatvertfnsgekl
    ediyvetrelqylypegeemvfmdletyeqfavprsrvvgaeffkegmtalgdmyegqpi
    kvtpptvvelkvvdtppgvrgdtvsggskpatletgavvqvplfvepgevikvdtrtgey
    vgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uebB (B:)
    misvtdlrpgtkvkmdgglwecveyqhqklgrggakvvakfknletgatvertfnsgekl
    ediyvetrelqylypegeemvfmdletyeqfavprsrvvgaeffkegmtalgdmyegqpi
    kvtpptvvelkvvdtppgsggskpatletgavvqvplfvepgevikvdtrtgeyvgra