PDB entry 1uea

View 1uea on RCSB PDB site
Description: mmp-3/timp-1 complex
Class: complex (metalloprotease/inhibitor)
Keywords: proteinase, zinc-endopeptidase, proteinase inhibitor, complex, mmps (matrix metallo proteinases) timps (tissue inhibitor of metallo proteinases), metzincins, complex (metalloprotease/inhibitor)
Deposited on 1997-06-06, released 1998-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08254 (0-End)
      • engineered (60)
      • engineered (136)
    Domains in SCOPe 2.07: d1ueaa_
  • Chain 'B':
    Compound: tissue inhibitor of metalloproteinase-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01033 (0-End)
      • engineered (29)
      • engineered (77)
    Domains in SCOPe 2.07: d1ueab_
  • Chain 'C':
    Compound: Matrix metalloproteinase-3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08254 (0-End)
      • engineered (60)
      • engineered (136)
    Domains in SCOPe 2.07: d1ueac_
  • Chain 'D':
    Compound: tissue inhibitor of metalloproteinase-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01033 (0-End)
      • engineered (29)
      • engineered (77)
    Domains in SCOPe 2.07: d1uead_
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ueaA (A:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ueaA (A:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ueaB (B:)
    ctcvpphpqtafcnsdlvirakfvgtpevaqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrsharseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgceectvfpclsipcklqsgthclwtdqllqgsekgfqsrhlaclprepglctwqslr
    sqia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ueaB (B:)
    ctcvpphpqtafcnsdlvirakfvgtpevaqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrsharseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgceectvfpclsipcklqsgthclwtdqllqgsekgfqsrhlaclprepglctwqslr
    s
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ueaC (C:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygpppdspet
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ueaC (C:)
    frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
    misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
    ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ueaD (D:)
    ctcvpphpqtafcnsdlvirakfvgtpevaqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrsharseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgceectvfpclsipcklqsgthclwtdqllqgsekgfqsrhlaclprepglctwqslr
    sqia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ueaD (D:)
    ctcvpphpqtafcnsdlvirakfvgtpevaqttlyqryeikmtkmykgfqalgdaadirf
    vytpamesvcgyfhrsharseefliagklqdgllhittcsfvapwnslslaqrrgftkty
    tvgceectvfpclsipcklqsgthclwtdqllqgsekgfqsrhlaclprepglctwqslr
    s