PDB entry 1ue9

View 1ue9 on RCSB PDB site
Description: Solution structure of the fourth SH3 domain of human intersectin 2 (KIAA1256)
Class: endocytosis/exocytosis
Keywords: BETA BARREL, SH3 DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2003-05-09, released 2003-11-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intersectin 2
    Species: Homo sapiens [TaxId:9606]
    Gene: Kazusa cDNA hh15293
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZM3 (7-73)
      • cloning artifact (0-6)
      • cloning artifact (74-79)
    Domains in SCOPe 2.01: d1ue9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ue9A (A:)
    gssgssgeiaqvtsayvasgseqlslapgqlililkkntsgwwqgelqargkkrqkgwfp
    ashvkllgpsserasgpssg