PDB entry 1ue7

View 1ue7 on RCSB PDB site
Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
Deposited on 2003-05-09, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.235
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ue7a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ue7b_
  • Chain 'C':
    Domains in SCOP 1.67: d1ue7c_
  • Chain 'D':
    Domains in SCOP 1.67: d1ue7d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ue7A (A:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue7A (A:)
    gdttitivgnltadpelrftpsgaavanftvastpriydrdgealflrcniwreaaenva
    esltrgarvivsgrlkqrtvievevdeigpslryatakvnkasrsg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ue7B (B:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue7B (B:)
    gdttitivgnltadpelrftpsgaavanftvastealflrcniwreaaenvaesltrgar
    vivsgrlkqrstvievevdeigpslryatakvnkasrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ue7C (C:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue7C (C:)
    agdttitivgnltadpelrftpsgaavanftvastealflrcniwreaaenvaesltrga
    rvivsgrlkqregekrtvievevdeigpslryatakvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ue7D (D:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue7D (D:)
    gdttitivgnltadpelrftpsgaavanftvastprealflrcniwreaaenvaesltrg
    arvivsgrlkqrstvievevdeigpslryatakvn