PDB entry 1ue6

View 1ue6 on RCSB PDB site
Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
Class: DNA binding protein
Keywords: OLIGONUCLEOTIDE BINDING FOLD, DNA-BINDING PROTEIN, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, DNA BINDING PROTEIN
Deposited on 2003-05-09, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.231
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-strand binding protein
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ue6a_
  • Chain 'B':
    Compound: Single-strand binding protein
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ue6b_
  • Chain 'C':
    Compound: Single-strand binding protein
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ue6c_
  • Chain 'D':
    Compound: Single-strand binding protein
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ue6d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ue6A (A:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue6A (A:)
    agdttitivgnltadpelrftpsgaavanftvastpriydrqwkdgealflrcniwreaa
    envaesltrgarvivsgrlkqrstvievevdeigpslryatakvnkasrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ue6B (B:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue6B (B:)
    gdttitivgnltadpelrftpsgaavanftvastpriealflrcniwreaaenvaesltr
    garvivsgrlkqrsfettvievevdeigpslryatakvnkasrsgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ue6C (C:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue6C (C:)
    gdttitivgnltadpelrftpsgaavanftvastpealflrcniwreaaenvaesltrga
    rvivsgrlkqrsfetregekrtvievevdeigpslryatakvnkas
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ue6D (D:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue6D (D:)
    gdttitivgnltadpelrftpsgaavanftvastpriyealflrcniwreaaenvaeslt
    rgarvivsgrlkqrsfetrkrtvievevdeigpslryatakvnk