PDB entry 1ue1

View 1ue1 on RCSB PDB site
Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
Deposited on 2003-05-08, released 2004-02-10
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-10, with a file datestamp of 2004-02-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1ue1a_
  • Chain 'B':
    Domains in SCOP 1.67: d1ue1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ue1A (A:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue1A (A:)
    gdttitivgnltadpelrftpsgaavanftvastpriydwkdgealflrcniwreaaenv
    aesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ue1B (B:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue1B (B:)
    agdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwr
    eaaenvaesltrgarvivsgrlkqrsfetrkrtvievevdeigpslryatakvnkasrs