PDB entry 1ue1

View 1ue1 on RCSB PDB site
Description: Crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis
Class: DNA binding protein
Keywords: OLIGONUCLEOTIDE BINDING FOLD, DNA-BINDING PROTEIN, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, DNA BINDING PROTEIN
Deposited on 2003-05-08, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single-strand binding protein
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ue1a_
  • Chain 'B':
    Compound: Single-strand binding protein
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ue1b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ue1A (A:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue1A (A:)
    gdttitivgnltadpelrftpsgaavanftvastpriydwkdgealflrcniwreaaenv
    aesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ue1B (B:)
    magdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniw
    reaaenvaesltrgarvivsgrlkqrsfetregekrtvievevdeigpslryatakvnka
    srsggfgsgsrpapaqtssasgddpwgsapasgsfgggddeppf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue1B (B:)
    agdttitivgnltadpelrftpsgaavanftvastpriydrqtgewkdgealflrcniwr
    eaaenvaesltrgarvivsgrlkqrsfetrkrtvievevdeigpslryatakvnkasrs