PDB entry 1ue0

View 1ue0 on RCSB PDB site
Description: Isoleucyl-tRNA synthetase editing domain complexed with L-Valine
Class: ligase
Keywords: aminoacyl-trna synthetase, CP1, editing, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, LIGASE
Deposited on 2003-05-08, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isoleucyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: iles
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56690 (1-181)
      • see remark 999 (74)
      • see remark 999 (175)
    Domains in SCOPe 2.07: d1ue0a_
  • Chain 'B':
    Compound: isoleucyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Gene: iles
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56690 (Start-181)
      • see remark 999 (74)
      • see remark 999 (175)
    Domains in SCOPe 2.07: d1ue0b_
  • Heterogens: VAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ue0A (A:)
    mqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdeali
    leeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivh
    qapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfke
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue0A (A:)
    qdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealil
    eeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhq
    apafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfkee
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ue0B (B:)
    mqdpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdeali
    leeglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivh
    qapafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfke
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ue0B (B:)
    dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile
    eglgrkllgegtqvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa
    pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgflfkees