PDB entry 1udy

View 1udy on RCSB PDB site
Description: Medium-Chain Acyl-CoA Dehydrogenase with 3-Thiaoctanoyl-CoA
Class: Oxidoreductase
Keywords: MCAD complex
Deposited on 2003-05-07, released 2003-12-09
The last revision prior to the SCOP 1.73 freeze date was dated 2003-12-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific
    Species: SUS SCROFA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41367
      • see remark 999 (14)
      • see remark 999 (257)
      • see remark 999 (279)
      • see remark 999 (305)
    Domains in SCOP 1.73: d1udya1, d1udya2
  • Chain 'B':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific
    Species: SUS SCROFA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41367
      • see remark 999 (14)
      • see remark 999 (257)
      • see remark 999 (279)
      • see remark 999 (305)
    Domains in SCOP 1.73: d1udyb1, d1udyb2
  • Chain 'C':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific
    Species: SUS SCROFA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41367
      • see remark 999 (14)
      • see remark 999 (257)
      • see remark 999 (279)
      • see remark 999 (305)
    Domains in SCOP 1.73: d1udyc1, d1udyc2
  • Chain 'D':
    Compound: Acyl-CoA dehydrogenase, medium-chain specific
    Species: SUS SCROFA
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41367
      • see remark 999 (14)
      • see remark 999 (257)
      • see remark 999 (279)
      • see remark 999 (305)
    Domains in SCOP 1.73: d1udyd1, d1udyd2
  • Heterogens: FAD, CS8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1udyA (A:)
    kavpqcepgsgfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelg
    lmnthipesfgglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapaskaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltg
    egagfkiamgtfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisfllad
    mamkvelarlsyqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfntey
    pveklmrdakiyqiyegtaqiqriiiarehigrykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udyA (A:)
    gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
    gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
    caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
    skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltgegagfkiamg
    tfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladmamkvelarl
    syqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteypveklmrdak
    iyqiyegtaqiqriiiarehigryk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1udyB (B:)
    kavpqcepgsgfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelg
    lmnthipesfgglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapaskaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltg
    egagfkiamgtfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisfllad
    mamkvelarlsyqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfntey
    pveklmrdakiyqiyegtaqiqriiiarehigrykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udyB (B:)
    gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
    gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
    caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
    skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltgegagfkiamg
    tfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladmamkvelarl
    syqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteypveklmrdak
    iyqiyegtaqiqriiiarehigr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1udyC (C:)
    kavpqcepgsgfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelg
    lmnthipesfgglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapaskaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltg
    egagfkiamgtfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisfllad
    mamkvelarlsyqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfntey
    pveklmrdakiyqiyegtaqiqriiiarehigrykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udyC (C:)
    gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
    gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
    caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
    skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltgegagfkiamg
    tfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladmamkvelarl
    syqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteypveklmrdak
    iyqiyegtaqiqriiiarehigryk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1udyD (D:)
    kavpqcepgsgfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelg
    lmnthipesfgglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkky
    lgrmteeplmcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyflla
    rsdpdpkapaskaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltg
    egagfkiamgtfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisfllad
    mamkvelarlsyqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfntey
    pveklmrdakiyqiyegtaqiqriiiarehigrykn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udyD (D:)
    gfsfelteqqkefqatarkfareeiipvaaeydrtgeypvpllkrawelglmnthipesf
    gglglgiidscliteelaygctgvqtaieantlgqvpliiggnyqqqkkylgrmteeplm
    caycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkapa
    skaftgfiveadtpgvqigrkeinmgqrcsdtrgivfedvrvpkenvltgegagfkiamg
    tfdktrppvaagavglaqraldeatkyalerktfgkllaehqgisflladmamkvelarl
    syqraaweidsgrrntyyasiakayaadianqlatdavqvfggngfnteypveklmrdak
    iyqiyegtaqiqriiiarehigryk