PDB entry 1udx

View 1udx on RCSB PDB site
Description: Crystal structure of the conserved protein TT1381 from Thermus thermophilus HB8
Class: protein binding
Keywords: GTP-binding protein, Obg, TGS domain, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, PROTEIN BINDING
Deposited on 2003-05-07, released 2004-03-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.226
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: the GTP-binding protein Obg
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1udxa1, d1udxa2, d1udxa3
  • Heterogens: ACT, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1udxA (A:)
    mfqdvlvitvaagrggdgavsfrrekfvpkggpdggdggrggsvylrargsvdslsrlsk
    rtykaedgehgrgsqqhgrggedlvievprgtrvfdadtgelladlteegqtvlvargga
    ggrgnmhfvsptrqaprfaeageegekrrlrlelmliadvglvgypnagkssllaamtra
    hpkiapypfttlspnlgvvevseeerftladipgiiegasegkglgleflrhiartrvll
    yvldaadeplktletlrkevgaydpallrrpslvalnkvdlleeeavkaladalaregla
    vlpvsaltgaglpalkealhalvrstpppempkpvprkevqagvevvpvaegvyevrape
    verylarikgdlmeaagylqevfrrqgveaalrakgvragdlvrigglefeyipev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udxA (A:)
    mfqdvlvitvaagrggdgavsfrrekfvpkggpdggdggrggsvylrargsvdslsrlsk
    rtykaedgehgrgsqqhgrggedlvievprgtrvfdadtgelladlteegqtvlvargga
    ggrgnmhfvsptrqaprfaeageegekrrlrlelmliadvglvgypnagkssllaamtra
    hpkiapypfttlspnlgvvevseeerftladipgiiegasegkglgleflrhiartrvll
    yvldaadeplktletlrkevgaydpallrrpslvalnkvdlleeeavkaladalaregla
    vlpvsaltgaglpalkealhalvrstpppempkpvpqagvevvpvaegvyevrapevery
    larikgdlmeaagylqevfrrqgveaalrakgvragdlvrigglefeyipev