PDB entry 1udv

View 1udv on RCSB PDB site
Description: Crystal structure of the hyperthermophilic archaeal dna-binding protein Sso10b2 at 1.85 A
Deposited on 2003-05-07, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.239
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1udva_
  • Chain 'B':
    Domains in SCOP 1.67: d1udvb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1udvA (A:)
    mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
    vqlvnvqtgsevrdrrrisyillrlkrvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udvA (A:)
    teklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgv
    qlvnvqtgsevrdrrrisyillrlkrvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1udvB (B:)
    mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
    vqlvnvqtgsevrdrrrisyillrlkrvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1udvB (B:)
    klneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgvql
    vnvqtgsevrdrrrisyillrlkrvy